Protein coding transcript 257460

• Transcript: Ll_transcript_38127
• CDS coordinates: 1049-1378 (+)
• Peptide sequence: MLDAVLLNMKIHGRIIICGMISQYNISEPEPLKNIMQVAFKRLSIKGFTHRDHHHLYPKLLETVLPYIREKKIVYVEDIVEGIENGPEALVGLFSGRNFGKQIVAVAHE*
• ORF Type: complete

Annotations of Ll_transcript_38127

• Blastp: NADPH-dependent oxidoreductase 2-alkenal reductase from Arabidopsis with 57.8% of identity
• Blastx: NADPH-dependent oxidoreductase 2-alkenal reductase from Arabidopsis with 56.25% of identity
• Eggnog: alcohol dehydrogenase(COG2130)
• Kegg: Link to kegg annotations (AT5G16970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421610.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;