Protein coding transcript 257463

• Transcript: Ll_transcript_39274
• CDS coordinates: 162-533 (+)
• Peptide sequence: MASCSMALAASGFVLSPNVVTNSLSSKSSAMVMFPTKIINGSSRLVSVRAADEAASVTAPAPVGEVSKKPKPPPLGPKRGTKVKILRRESYWYKESGSVVAVDQDPKTRYPVVVRFNKVNYANA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_39274

• Blastp: Photosystem I reaction center subunit IV A, chloroplastic from Nicotiana with 58.27% of identity
• Blastx: Photosystem I reaction center subunit IV A, chloroplastic from Nicotiana with 50.36% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002390)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422789.1)
• Pfam: Photosystem I reaction centre subunit IV / PsaE (PF02427.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;