Protein coding transcript 257472

• Transcript: Ll_transcript_39299
• CDS coordinates: 259-1002 (+)
• Peptide sequence: MLRELIPHSDQKRDKASFLLEVIEYIHFLQEKVHKYEGSFQGWNHDPEKLMPWRNNDKPSESFEHGGTNSGPVPSPSFLFASKTNEKNIAISQTILGSTQNVESGLSTATNFKPMDHIPNSPQPNFFSPTQSGVVSQLARRLSSDAENAIYQPFEECRTMMATSEKLKDKELTIEGGAISISSVYSKGLLDTLTHALQSSGVDLSQTSMSVQIELGKQANIRPTVPMSMCGAKVYSHSYCPFVLSFL*
• ORF Type: complete

Annotations of Ll_transcript_39299

• Blastp: Transcription factor BIM2 from Arabidopsis with 40.79% of identity
• Blastx: Transcription factor BIM1 from Arabidopsis with 48.65% of identity
• Eggnog: Transcription factor(ENOG411216Z)
• Kegg: Link to kegg annotations (AT1G69010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439023.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;