Protein coding transcript 257477

• Transcript: Ll_transcript_39304
• CDS coordinates: 1455-2297 (+)
• Peptide sequence: MLRELIPHSDQKRDKASFLLEVIEYIHFLQDKVHKHEGSFQEWNHESEKLMPWRNNDRPAESFETRGTNSGSDPSPTLLFASKTDQKNITISPTIRGSIGHVESGLNSSTNFKTMDHHPGIMNNSFPIPISPQPNFFIPAQSGGSGGVVSQLAHGLTSDAENGIYQHSEECKTIAATSEKLKEKEPTLEGGAISISHAYSKGLLDTLTHALQSSGVDLSQSSISVQIELGKQTNRPTVPMSMCSAKGEEVPSDNQRMMRSRVASSENSDQPVKKLKTCRT*
• ORF Type: complete

Annotations of Ll_transcript_39304

• Blastp: Transcription factor BIM2 from Arabidopsis with 38.08% of identity
• Blastx: Transcription factor BIM1 from Arabidopsis with 47.2% of identity
• Eggnog: Transcription factor(ENOG411216Z)
• Kegg: Link to kegg annotations (AT1G69010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451881.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;