Protein coding transcript 257481

• Transcript: Ll_transcript_39278
• CDS coordinates: 762-1208 (+)
• Peptide sequence: MDHHPGITNKAFPVPISPQPNFFTPTQSGGQDGMMSQLTHRLAFDVENAIYQPSDECQTLTATSEKLKDKELTIEGGAISISSVYSKGLLDTLTHALQSSGVDLSQASISVQIELGKQANIRPTLPMSMSAAKDDEVPSNNQRMMRSRV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_39278

• Blastp: Transcription factor BIM2 from Arabidopsis with 58.82% of identity
• Blastx: Transcription factor BIM2 from Arabidopsis with 58.82% of identity
• Eggnog: Transcription factor(ENOG411216Z)
• Kegg: Link to kegg annotations (AT1G69010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464198.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;