Protein coding transcript 257483

• Transcript: Ll_transcript_39281
• CDS coordinates: 1-627 (+)
• Peptide sequence: RPPSQGSRLKTHDFLQPLERAEPKASAKEEATDEISSVAPKPPPPPPPSVEHLLPGGIGTYSISHISYSNNIHRVPKPETSTSLFSVHQATSTDRNDENSNCSSYTSSGFTLWEESAVKKGKTGKENNVASKPILGVAESAAKPGQWTLSERTSQSFSNNHHNSVNSRSSSQLVLRFLFLLFHGASFFFIFFIGKELRLKACYLHFYA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_39281

• Blastp: Transcription factor BIM1 from Arabidopsis with 52.41% of identity
• Blastx: Transcription factor BIM1 from Arabidopsis with 62.96% of identity
• Eggnog: Transcription factor(ENOG411216Z)
• Kegg: Link to kegg annotations (AT5G08130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464195.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;