Protein coding transcript 257485

• Transcript: Ll_transcript_39283
• CDS coordinates: 687-1730 (+)
• Peptide sequence: MMKSAKDGAQDEEIENEEAFFLKKESQRELKVKVDGKSTEQKPNTPRSKHSATEQRRRSKINDRFHMLRELIPHGDQKRDKASFLLEVIEYIHFLQEKVHKYEGSFQGWSHEPEKLMPWSNNDTPAESFEHRGANSGSGPSPSFLFASKTEEKNITIPLKTPGSIQNVESGLDTGTNFKTMDHHPGITNKAFPVPISPQPNFFTPTQSGGQDGMMSQLTHRLAFDVENAIYQPSDECQTLTATSEKLKDKELTIEGGAISISSVYSKGLLDTLTHALQSSGVDLSQASISVQIELGKQANIRPTLPMSMSAAKDDEVPSNNQRMMRSRVASSEKSDQAVKKLKTCRT*
• ORF Type: complete

Annotations of Ll_transcript_39283

• Blastp: Transcription factor BIM1 from Arabidopsis with 43.34% of identity
• Blastx: Transcription factor BIM1 from Arabidopsis with 43.61% of identity
• Eggnog: Transcription factor(ENOG411216Z)
• Kegg: Link to kegg annotations (AT5G08130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464195.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;