| Transcript | Ll_transcript_38065 |
|---|---|
| CDS coordinates | 185-511 (+) |
| Peptide sequence | MKNVQPKPHSASARSCTKVHKKGIALGRSVDLTKFSGYDELIAKLDQLLEFGGELTSPKKDWLIVYTDNEGDMMLVGDDPWPEFCAMACKMYIYPKEEIQKMTPGTLS* |
| ORF Type | complete |
| Blastp | Auxin response factor 24 from Oryza sativa with 67.29% of identity |
|---|---|
| Blastx | Auxin response factor 2A from Lycopersicon with 61.6% of identity |
| Eggnog | auxin response factor(ENOG4110RNJ) |
| Kegg | Link to kegg annotations (4352211) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457943.1) |
| Pfam | AUX/IAA family (PF02309.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer