Protein coding transcript 257598

• Transcript: Ll_transcript_38083
• CDS coordinates: 1-492 (+)
• Peptide sequence: MKTSEAMTLKDGDCKLFGISLRSSHDAQEPSALQRIGTSEPNGEMYLISHQQQNSENDQKSENLKSSRPSDGLVAADDHEKSKDVQAKLFSGSARSCTKVHKMGIALGRSVDLTKYSDYYGLIAELDRLFEFGGELMSANKDWLIVYTDNEGDMMLVGDDPWQ*
• ORF Type: complete

Annotations of Ll_transcript_38083

• Blastp: Auxin response factor 2B from Lycopersicon with 49.11% of identity
• Blastx: Auxin response factor 2B from Lycopersicon with 49.11% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (101249712)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430108.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;