Protein coding transcript 2576

• Transcript: Ll_transcript_301445
• CDS coordinates: 27-347 (+)
• Peptide sequence: MPKEVKQKSGLIVGLNAGHKVTPRTPAPRISRRKGFLSKRTAFVREITKEVAGLAPYEKRIIELLRNSKDKRARRLAKKRLGTFGRSKRKVDEMTRVIAESKRAGH*
• ORF Type: complete

Annotations of Ll_transcript_301445

• Blastp: 60S ribosomal protein L36 from Trichoderma with 76.92% of identity
• Blastx: 60S ribosomal protein L36 from Trichoderma with 76.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004496553.1)
• Pfam: Ribosomal protein L36e (PF01158.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;