Protein coding transcript 257615

• Transcript: Ll_transcript_38369
• CDS coordinates: 1-300 (+)
• Peptide sequence: LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLHEDELRDAVLLVFANKQDLPNAMNA
• ORF Type: internal

Annotations of Ll_transcript_38369

• Blastp: ADP-ribosylation factor from Vigna with 99% of identity
• Blastx: ADP-ribosylation factor from Vigna with 99% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000094)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014513266.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;