Protein coding transcript 257665

• Transcript: Ll_transcript_37564
• CDS coordinates: 3-317 (+)
• Peptide sequence: GLVSDLFPKSLKGFIDVAESEVASLTNLYSVVGRNADELALYFGEDPARCPFEQVTVTILNFVRLFRKAHEENCKLAELEKKKAENEANMEKAKGKTKKSAKDS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_37564

• Blastp: Formin-like protein 20 from Arabidopsis with 71.7% of identity
• Blastx: Formin-like protein 20 from Arabidopsis with 72.86% of identity
• Eggnog: FH2(ENOG41100UH)
• Kegg: Link to kegg annotations (AT5G07740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463428.1)
• Pfam: Formin Homology 2 Domain (PF02181.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;