Protein coding transcript 257739

• Transcript: Ll_transcript_37761
• CDS coordinates: 1-558 (+)
• Peptide sequence: KEGCWTISNITAGNKEQIQAVIEAGLIAPLVNLLLNAEFDIKKEAAWAISNATSGGTHDQIKYLVSQGCIKPLCDLLVCPDPRIVTVCLEGLENILKVGESEKSLGNTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEDEDETLPPGDNAQGGFNFGSSELPVPSGGFNFS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_37761

• Blastp: Importin subunit alpha-1b from Oryza sativa with 84.78% of identity
• Blastx: Importin subunit alpha-1b from Oryza sativa with 84.78% of identity
• Eggnog: importin subunit alpha(COG5064)
• Kegg: Link to kegg annotations (4337853)
• CantataDB: Link to cantataDB annotations (CNT0000957)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418945.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;