Protein coding transcript 257798

• Transcript: Ll_transcript_37313
• CDS coordinates: 811-1344 (+)
• Peptide sequence: MSTLGLSQKPIYVQAVREAPERNGIDGLDTLETIPDAVPTVFTEPPIEDQLAWHTLWPESHKLYGHGNELFSLRCDHKGELVASSCKAQSASVAKVWLWEVGSWKSVGCLQSHSLTVTQMEFSHDDNFLLTVSRDRQFSISTITRRDTGGISFSLLARQEGHKRIIWSCSWHPHTWL*
• ORF Type: complete

Annotations of Ll_transcript_37313

• Blastp: Elongator complex protein 2 from Arabidopsis with 70.11% of identity
• Blastx: Elongator complex protein 2 from Arabidopsis with 59.44% of identity
• Eggnog: elongator acetyltransferase complex subunit 2(ENOG410XRF0)
• Kegg: Link to kegg annotations (AT1G49540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441428.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;