Protein coding transcript 257809

• Transcript: Ll_transcript_37868
• CDS coordinates: 314-664 (+)
• Peptide sequence: MPSLQLLQLTQHGQSFLASRRKTLLLATGILAAGGAAAYMQSRFRVNKHDLLGHCNGHNNDKEVAKDEVMKDAADSKNKQKKGGLKSLQVLAAVLLSEMGQLGARDLLALVGIVVS*
• ORF Type: complete

Annotations of Ll_transcript_37868

• Blastp: ABC transporter D family member 1 from Arabidopsis with 55.56% of identity
• Blastx: ABC transporter D family member 1 from Arabidopsis with 55.56% of identity
• Eggnog: (ABC) transporter(COG4178)
• Kegg: Link to kegg annotations (AT4G39850)
• CantataDB: Link to cantataDB annotations (CNT0000069)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437629.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;