Transcript | Ll_transcript_301484 |
---|---|
CDS coordinates | 82-393 (+) |
Peptide sequence | MANTIMQQFWDSAFALEPVEDYDTHSEISGLLSFDGADTTKSMCKSVGFGSSFAFKFEDLNGRVHRINCGEHLDELISAIMQRVGDVNNGEHPIILYEDDEGDK |
ORF Type | 3prime_partial |
Blastp | CBS domain-containing protein CBSCBSPB3 from Arabidopsis with 56.48% of identity |
---|---|
Blastx | CBS domain-containing protein CBSCBSPB3 from Arabidopsis with 55.56% of identity |
Eggnog | Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0517) |
Kegg | Link to kegg annotations (AT3G52950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429745.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer