Transcript | Ll_transcript_39696 |
---|---|
CDS coordinates | 2-376 (+) |
Peptide sequence | EEREQEQGSSSSSHRQSVYGRRQYHESREQREETEQEQGSRSDSRRQRNPYHFSSGRFQTRYRNRNGQIRVLERFDQRTNRLENLKNYRIVEFQSKPNTLILPKHSDADYIIVVLNGNYYQIFK* |
ORF Type | 5prime_partial |
Blastp | Conglutin beta 7 from Lupinus with 88.89% of identity |
---|---|
Blastx | Conglutin beta 7 from Lupinus with 71.83% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439203.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer