| Transcript | Ll_transcript_39000 |
|---|---|
| CDS coordinates | 2-352 (+) |
| Peptide sequence | LYHIFVDGLGSQSKSDQLALASGDPEESVSDVGNTVDSGSKGSDSLTHQFSVANSTTTTYKDEFDSSVAILNIAIIWFHFHDYAKTLSVLEPLFQNIEPIDETTALHICLLLLDASL |
| ORF Type | internal |
| Blastp | CCR4-NOT transcription complex subunit 10 from Macaca with 39.62% of identity |
|---|---|
| Blastx | CCR4-NOT transcription complex subunit 10 from Macaca with 39.62% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464220.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer