Protein coding transcript 257972

• Transcript: Ll_transcript_39006
• CDS coordinates: 166-771 (+)
• Peptide sequence: MENRDSSTSSPSSSANRDASFATDNDDGVFAVTVALAKDAALHFQSGKFAECVQVLIQLLQKKQNDPKVLHNIAIAEFFRDACSDPKKLLEVLKSVKSKSDQLALASGDPEESVSDVGNTVDSGSKGSDSLTHQFSVANSTTTTYKDEFDSSVAILNIAIIWFHFHDYAKTLSVLEPLFQNIEPIDETTALHICLLLLDASL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_39006

• Blastp: CCR4-NOT transcription complex subunit 10 from Macaca with 27.53% of identity
• Blastx: CCR4-NOT transcription complex subunit 10 from Macaca with 26.4% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464220.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;