Protein coding transcript 258001

• Transcript: Ll_transcript_37040
• CDS coordinates: 1-537 (+)
• Peptide sequence: IQETKPFYIENYILVHYKPCKVRVFLILYAIMLFSQMGSMLLIFVGFLLFFGEMLAMETNLDEEELLGLYEVMNALVDEPDLAQTYPQPCSETPWPGVQCEESIDDPPIFHVTKIHIGPDIFFPPCKTSAYLSQSLLKLTYLKTLSIFNCFVSSPVTLPNTLFGPFSSLEHLSLESNPS
• ORF Type: internal

Annotations of Ll_transcript_37040

• Blastp: Piriformospora indica-insensitive protein 2 from Arabidopsis with 33.86% of identity
• Blastx: Piriformospora indica-insensitive protein 2 from Arabidopsis with 33.86% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G13230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431771.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;