Protein coding transcript 258003

• Transcript: Ll_transcript_37034
• CDS coordinates: 101-427 (+)
• Peptide sequence: MAMANKFLLVLFFTLVAISMLQTLVMASHGHGGHHYNNKRKYGPGSLQSYQCPSQCSRRCSQTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_37034

• Blastp: Gibberellin-regulated protein 4 from Arabidopsis with 62.62% of identity
• Blastx: Gibberellin-regulated protein 4 from Arabidopsis with 62.62% of identity
• Eggnog: Gibberellin-regulated protein(ENOG410YQ6U)
• Kegg: Link to kegg annotations (AT5G15230)
• CantataDB: Link to cantataDB annotations (CNT0002883)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442661.1)
• Pfam: Gibberellin regulated protein (PF02704.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;