Protein coding transcript 258086

• Transcript: Ll_transcript_38533
• CDS coordinates: 225-764 (+)
• Peptide sequence: MRKLRWVMDGGGFWDLDISTPKTLDGLASPVPDNPLPLGLSRGTRLSRHKQIEFMQRFMHAHLTPTFAKPLGFTLQRVLTLPFSDNWNVFLLGQFNFQKFVSSIKSSEEIQVGVSSWLKTFQRHLKQKSLYALGFCSEFHLTPDDTILFGLDAYDYTDKPRGKAVLHHKVSISLYPVNI*
• ORF Type: complete

Annotations of Ll_transcript_38533

• Blastp: Protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic from Arabidopsis with 55.98% of identity
• Blastx: Protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic from Arabidopsis with 56.42% of identity
• Eggnog: NA(ENOG4111J7E)
• Kegg: Link to kegg annotations (AT3G06960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426245.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;