Protein coding transcript 258143

• Transcript: Ll_transcript_39575
• CDS coordinates: 189-860 (+)
• Peptide sequence: MASFRIRNLLQLRFSVHTTPFSSPGTSRTFSVLESSQHSVLKPDAVNHSLHDEEIAALRREFEAAKQSFRNIPDAIKDMPKMNPKGIYVNKNLRLDKLQVYGFDYDYTLAHYSSHLQTLIYDLAKEYMVNELRYPEGCMDFKYDPTFPIRGLYYDKLKGCLMKLDFFGSIETDGCYFGRHKLSSMGIHKIYGTRHIGHDHVWSLVGLMDFFCFSEVSSLWFSH*
• ORF Type: complete

Annotations of Ll_transcript_39575

• Blastp: 5'-nucleotidase domain-containing protein DDB_G0275467 from Dictyostelium with 41.73% of identity
• Blastx: 5'-nucleotidase domain-containing protein DDB_G0275467 from Dictyostelium with 41.73% of identity
• Eggnog: 5-nucleotidase domain containing(ENOG410XT8W)
• Kegg: Link to kegg annotations (DDB_G0275467)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441918.1)
• Pfam: 5' nucleotidase family (PF05761.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;