Protein coding transcript 258186

• Transcript: Ll_transcript_38414
• CDS coordinates: 56-868 (+)
• Peptide sequence: MEPQHSDQPLFLHQQQQQKQQQQQQQFLHMSRQPSQAAAAQFNLLHQQRLLQLQQQQQQLLKTMPQQRPQLPQQFQQQNMPIRSPVKPSYEPGMCARRLTHYMYQQQHRPEDNNIEFWRKFVAEYFAPNAKKKWCVSLYGSGRQTTGVFPQDVWHCEICNRKPGRGFEATVEVLPRLYKIKYESGTLEELLYVDMPREYHNSSGQIVLDYAKAIQESVFEQLRVVRDGQLRIVFSQDLKICSWEFCARRHEELIPRRLLIPQVSDYVVAL*
• ORF Type: complete

Annotations of Ll_transcript_38414

• Blastp: Transcriptional corepressor SEUSS from Arabidopsis with 90.11% of identity
• Blastx: Transcriptional corepressor SEUSS from Arabidopsis with 90.11% of identity
• Eggnog: NA(ENOG410XT7C)
• Kegg: Link to kegg annotations (AT1G43850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438622.1)
• Pfam: LIM-domain binding protein (PF01803.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;