Transcript | Ll_transcript_38420 |
---|---|
CDS coordinates | 1-447 (+) |
Peptide sequence | AAQFNLLHQQRILQLQQHQQQQLLKGMPQQRPQLPQQFQQQQNMPIRSPVKPVYEPGMCARRLTNYMYQQQHRPEDNNIEFWRKFVAEYFAPNAKKKWCVSLYGSGRQTTGVFPQDVWHCEICNHKPGRGFEATVEVLPRLYKIKYESG |
ORF Type | internal |
Blastp | Transcriptional corepressor SEUSS from Arabidopsis with 89.32% of identity |
---|---|
Blastx | Transcriptional corepressor SEUSS from Arabidopsis with 89.32% of identity |
Eggnog | NA(ENOG410XT7C) |
Kegg | Link to kegg annotations (AT1G43850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415067.1) |
Pfam | LIM-domain binding protein (PF01803.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer