Protein coding transcript 2583

• Transcript: Ll_transcript_301487
• CDS coordinates: 1-693 (+)
• Peptide sequence: HEPVKMYSNDNIPIHHEPGPNPKPLQRHRTTRYYMQRVQDSLTTRVSKIICTIFLGLLFIAGLIAFILWLSLRPHRPRFFIHDFSVPGLAQESGFENAQITFNVTARNSNQQVGVYYESMVGSVFFQEQKIGSMPLLFPFYQEPKNTTVVDGVLSGATLTVNSERWGEFQGERVHGSVVFRLELTSVIEFHIHTWGSKRHTMHANCDVGVGPDGYILLAYRDKRCPVYFS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_301487

• Blastp: Protein NDR1 from Arabidopsis with 29.12% of identity
• Blastx: NDR1/HIN1-like protein 13 from Arabidopsis with 33.33% of identity
• Eggnog: disease resistance(ENOG41113EN)
• Kegg: Link to kegg annotations (AT3G20600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451536.1)
• Pfam: Late embryogenesis abundant protein (PF03168.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;