Protein coding transcript 258332

• Transcript: Ll_transcript_37941
• CDS coordinates: 3-371 (-)
• Peptide sequence: EVSELRKIADTQKIENSELKAKWKEEKVALEKSRSDAETKYDEINEQNKILHSQLEALHIRWAEKERNYAGVSSGSSRADLLGDASLQNVINYLRRSKEIAETEVSLLKQEKLRLQSQLESAL
• ORF Type: internal

Annotations of Ll_transcript_37941

• Blastp: Nuclear-pore anchor from Arabidopsis with 64.23% of identity
• Blastx: Nuclear-pore anchor from Arabidopsis with 64.23% of identity
• Eggnog: translocated promoter region, nuclear basket protein(ENOG410XSA1)
• Kegg: Link to kegg annotations (AT1G79280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455453.1)
• Pfam: TPR/MLP1/MLP2-like protein (PF07926.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;