Protein coding transcript 258370

• Transcript: Ll_transcript_39602
• CDS coordinates: 321-1346 (+)
• Peptide sequence: MKLYVSTKGIKRVGNGSPKNTATAAAAAAAATTGRRISSRTVIPAVVVLGMLSLFAFLRVAIFALDSNFICSSFDCVGWRFFSSGDTTMKLRAELIRALMEANDDNVNERGADTFNELVNVMASKQDLKAFAFNTKAMFLQMERRVQSARKQESVSWHIASHGFPKGLHCLSLKLAEEYAVNAMARSRLPPPEYASRLVDPTFHHLVLFTDNVLAASVVVASTVENSANPEKLVFHIVTDKKTYTAMHAWFSINTIKSAVVEVRGLHHYVWSEEANAGVKVMLETNHLIWKHYYNNHIENDLHDGDELNRYLEALGPSTLSLLNHLRIYLPEVIFSCLLYL*
• ORF Type: complete

Annotations of Ll_transcript_39602

• Blastp: Probable galacturonosyltransferase 15 from Arabidopsis with 52.74% of identity
• Blastx: Probable galacturonosyltransferase 15 from Arabidopsis with 52.74% of identity
• Eggnog: glycosyltransferase 8 domain containing(ENOG41106K3)
• Kegg: Link to kegg annotations (AT3G58790)
• CantataDB: Link to cantataDB annotations (CNT0002927)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435302.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;