Transcript | Ll_transcript_39596 |
---|---|
CDS coordinates | 1004-1909 (+) |
Peptide sequence | MQFLQMERRVQSARKQESVSWHIASHGFPKGLHCLSLKLAEEYAVNAMARSRLPPPEYASRLVDPTFHHLVLFTDNVLAASVVVASTVENSANPEKLVFHIVTDKKTYTAMHAWFSINTIKSAVVEVRGLHHYVWSEEANAGVKVMLETNHLIWKHYYNNHIENDLHDGDELNRYLEALGPSTLSLLNHLRIYLPELFPDLNKVVFLDDDVVVQRDISSLWELNLNGKVSGSVFKSWCKDGCCHGNKYANFLNFSHPFISSNFVSDLCAWAYGMNIFDLEAWRRTNITETYHHWLRLVSIC* |
ORF Type | complete |
Blastp | Probable galacturonosyltransferase 15 from Arabidopsis with 65.66% of identity |
---|---|
Blastx | Probable galacturonosyltransferase 15 from Arabidopsis with 65.66% of identity |
Eggnog | glycosyltransferase 8 domain containing(ENOG41106K3) |
Kegg | Link to kegg annotations (AT3G58790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435302.1) |
Pfam | Glycosyl transferase family 8 (PF01501.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer