Protein coding transcript 258373

• Transcript: Ll_transcript_39596
• CDS coordinates: 1004-1909 (+)
• Peptide sequence: MQFLQMERRVQSARKQESVSWHIASHGFPKGLHCLSLKLAEEYAVNAMARSRLPPPEYASRLVDPTFHHLVLFTDNVLAASVVVASTVENSANPEKLVFHIVTDKKTYTAMHAWFSINTIKSAVVEVRGLHHYVWSEEANAGVKVMLETNHLIWKHYYNNHIENDLHDGDELNRYLEALGPSTLSLLNHLRIYLPELFPDLNKVVFLDDDVVVQRDISSLWELNLNGKVSGSVFKSWCKDGCCHGNKYANFLNFSHPFISSNFVSDLCAWAYGMNIFDLEAWRRTNITETYHHWLRLVSIC*
• ORF Type: complete

Annotations of Ll_transcript_39596

• Blastp: Probable galacturonosyltransferase 15 from Arabidopsis with 65.66% of identity
• Blastx: Probable galacturonosyltransferase 15 from Arabidopsis with 65.66% of identity
• Eggnog: glycosyltransferase 8 domain containing(ENOG41106K3)
• Kegg: Link to kegg annotations (AT3G58790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435302.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;