Protein coding transcript 258388

• Transcript: Ll_transcript_38474
• CDS coordinates: 809-1303 (+)
• Peptide sequence: MAGYSLVCYLLQVKDRHNGNLLMDEEGHIIHIDFGFMLSNSPGGVNFESAPFKLTRELLEVMDSDAEGIPSEFFDYFKVLCIQGFLTCRKHAERIILLVEMLQDSGFPCFKGGPRTIQNLRKRFHLGLTEEQCVSLVLSLISSSLDAWRTRQYDYYQKVLNGIL*
• ORF Type: complete

Annotations of Ll_transcript_38474

• Blastp: Phosphatidylinositol 4-kinase beta 1 from Arabidopsis with 96.95% of identity
• Blastx: Phosphatidylinositol 4-kinase beta 1 from Arabidopsis with 91.46% of identity
• Eggnog: phosphatidylinositol 4-kinase(ENOG410XPH3)
• Kegg: Link to kegg annotations (AT5G64070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430183.1)
• Pfam: Phosphatidylinositol 3- and 4-kinase (PF00454.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;