Protein coding transcript 258420

• Transcript: Ll_transcript_37726
• CDS coordinates: 600-1121 (+)
• Peptide sequence: MCFVLFFMYVVRISHNVAGTAMGRIVQGTKVLAHGGTEKLFQQIFGNFPAEKLLNSYTCYISTSSGPVLGTLYVSTIRLAFCSDNPLSHNTLAMQNRGNHYKVVVPLDQVSMVTPSSNRLNPKEKYIELVTVDGYEFFFMGLLAYENALKTIKEALPQYHKYYRGNLSVQVLL*
• ORF Type: complete

Annotations of Ll_transcript_37726

• Blastp: GLABRA2 expression modulator from Arabidopsis with 50.68% of identity
• Blastx: GLABRA2 expression modulator from Arabidopsis with 50.68% of identity
• Eggnog: GRAM(ENOG410YEXI)
• Kegg: Link to kegg annotations (AT2G22475)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451394.1)
• Pfam: GRAM domain (PF02893.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;