Transcript | Ll_transcript_37727 |
---|---|
CDS coordinates | 73-762 (+) |
Peptide sequence | MNDHREIPVRSSYTGISNYGSNNNNPYVQISLVPTSPEAKNHQKPMDTVRGAIKQAETMADNFWNHMRISHNVAGTAMGRIVQGTKVLAHGGTEKLFQQIFGNFPAEKLLNSYTCYISTSSGPVLGTLYVSTIRLAFCSDNPLSHNTLAMQNRGNHYKVVVPLDQVSMVTPSSNRLNPKEKYIELVTVDGYEFFFMGLLAYENALKTIKEALPQYHKYYRGNLSVQVLL* |
ORF Type | complete |
Blastp | GEM-like protein 1 from Arabidopsis with 45.27% of identity |
---|---|
Blastx | GLABRA2 expression modulator from Arabidopsis with 45.73% of identity |
Eggnog | GEM-like protein(ENOG410YBXM) |
Kegg | Link to kegg annotations (AT1G28200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451394.1) |
Pfam | GRAM domain (PF02893.19) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer