Protein coding transcript 25843

• Transcript: Ll_transcript_521019
• CDS coordinates: 3-626 (+)
• Peptide sequence: TVDAMATISAAPIVIDGKGHLLGRLASIVAKQLLTGQKVVVVRCELLNASGSFFRNKLRYHDYLHKRHLVNPKKSGPFHFRAPSRIFYKAIRGMVPHKTSRGAAALERLKVFEGVPPPYDRKKKMVVPSALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGAAYYERKKAARRSLAEAQKTAKVDDKVKTELASYGY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_521019

• Blastp: 60S ribosomal protein L16 from Neurospora with 77.44% of identity
• Blastx: 60S ribosomal protein L16 from Neurospora with 77.44% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU01221)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016184124.1)
• Pfam: Ribosomal protein L13 (PF00572.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;