| Transcript | Ll_transcript_37711 |
|---|---|
| CDS coordinates | 73-762 (+) |
| Peptide sequence | MNDHREIPVRSSYTGISNYGSNNNNPYVQISLVPTSPEAKNHQKPMDTVRGAIKQAETMADNFWNHMRISHNVAGTAMGRIVQGTKVLAHGGTEKLFQQIFGNFPAEKLLNSYTCYISTSSGPVLGTLYVSTIRLAFCSDNPLSHNTLAMQNRGNHYKVVVPLDQVSMVTPSSNRLNPKEKYIELVTVDGYEFFFMGLLAYENALKTIKEALPQYHKYYRGNLSVQVLL* |
| ORF Type | complete |
| Blastp | GEM-like protein 1 from Arabidopsis with 45.27% of identity |
|---|---|
| Blastx | GLABRA2 expression modulator from Arabidopsis with 45.73% of identity |
| Eggnog | GEM-like protein(ENOG410YBXM) |
| Kegg | Link to kegg annotations (AT1G28200) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451394.1) |
| Pfam | GRAM domain (PF02893.19) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer