Protein coding transcript 258437

• Transcript: Ll_transcript_38586
• CDS coordinates: 2-367 (+)
• Peptide sequence: FIKPSARFFLFQHNPLNTANEIAKQINDSKPVIAFTTSQLITKIIASSPKLPIILIEENEELQHSGVIDNHHSDFPSSLNVGDNHSYVLCEFFKDAQKKVLPVCRSRLKNVPVARDYTPIN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_38586

• Blastp: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 71.11% of identity
• Blastx: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 72.97% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG0318)
• Kegg: Link to kegg annotations (AT1G20510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462085.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;