Protein coding transcript 258439

• Transcript: Ll_transcript_38597
• CDS coordinates: 113-1147 (+)
• Peptide sequence: MANQKIDPRSGFNTSNSTFYTKRKPLPLPQNHFLDVTTFISSHSHRGNIAFIDSATRRHFTFPQLWLAVDSVSSALSSLGIRKGDVVLLLSPNSIYFPVVCLAVMSLGAIVTTTNPLNTANEIAKQINDSKPVIAFTTSQLITKITASSPNLPIILIEENEELQHSGVIDTLQNLMKKEPSVNRVKERVNQDDTATLLYSSGTTGPSKGVVSSHRNLISMVQIVQSRFKSDDLQTFICTVPMFHIYGLIAFATGILALGSTVVVLSKFDMHEMLFSIEKFRATYLPLVPPILVAMLNNAEAIRAKYDLSSLHTVLSGGAPLSKEVTEGFVEKYPNVAILQGYGLT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_38597

• Blastp: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 71.85% of identity
• Blastx: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 70.67% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG0318)
• Kegg: Link to kegg annotations (AT1G20510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414061.1)
• Pfam: AMP-binding enzyme (PF00501.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;