Transcript | Ll_transcript_38601 |
---|---|
CDS coordinates | 190-897 (+) |
Peptide sequence | MGRGGKSRTQRKHFRQSRENVWKRSKIDPNSNPNDENRTQTNPNPWTPFSTENPSFDHYYKEQHIVNDQEWEQFVTVLRTPLPASFRINSSTQFADDIRSQLENDFAHSLRDEVAEGGETEAIRPLPWYPGNFAWHSNFSRMQLRKNQTLARFHEFLKLENEIGNITRQEAVSMVPPLFLDVHSDHFVLDMCAAPGSKTFQLLESIHQSTKIGSLPHGMVIANDLDVQRCNLLIH* |
ORF Type | complete |
Blastp | tRNA (cytosine(34)-C(5))-methyltransferase from Mus with 51.63% of identity |
---|---|
Blastx | tRNA (cytosine(34)-C(5))-methyltransferase from Mus with 49.76% of identity |
Eggnog | nOP2 Sun(COG0144) |
Kegg | Link to kegg annotations (28114) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462085.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer