Protein coding transcript 258443

• Transcript: Ll_transcript_38607
• CDS coordinates: 1064-1363 (+)
• Peptide sequence: MKLEIFQGRKLLVCVIGAPDHFVLDMCAAPGSKTSELLEAIHRSIKAGSLPHRMVIANDLDVQRCNLLIHQTKRMYIANLIITNHEVPDFQGCRLNRNC*
• ORF Type: complete

Annotations of Ll_transcript_38607

• Blastp: Multisite-specific tRNA:(cytosine-C(5))-methyltransferase from Saccharomyces with 48.75% of identity
• Blastx: Multisite-specific tRNA:(cytosine-C(5))-methyltransferase from Saccharomyces with 48.15% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YBL024W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462085.1)
• Pfam: 16S rRNA methyltransferase RsmB/F (PF01189.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;