Protein coding transcript 258445

• Transcript: Ll_transcript_38591
• CDS coordinates: 190-1023 (+)
• Peptide sequence: MGRGGKSRTQRKHFRQSRENVWKRSKIDPNSNPNDENRTQTNPNPWTPFSTENPSFDHYYKEQHIVNDQEWEQFVTVLRTPLPASFRINSSTQFADDIRSQLENDFAHSLRDEVAEGGETEAIRPLPWYPGNFAWHSNFSRMQLRKNQTLARFHEFLKLENEIGNITRQEAVSMVPPLFLDVHSDHFVLDMCAAPGSKTFQLLESIHQSTKIGSLPHGMVCVVLITHVFLCFYPFLISVMYKWFKSYMLFWTEHSSNFNLSWLCKLHMQSLMIIVFS*
• ORF Type: complete

Annotations of Ll_transcript_38591

• Blastp: tRNA (cytosine(34)-C(5))-methyltransferase from Mus with 50.3% of identity
• Blastx: tRNA (cytosine(34)-C(5))-methyltransferase from Mus with 50.3% of identity
• Eggnog: nOP2 Sun(COG0144)
• Kegg: Link to kegg annotations (28114)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462085.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;