Protein coding transcript 258446

• Transcript: Ll_transcript_38593
• CDS coordinates: 113-766 (+)
• Peptide sequence: MANQKIDPRSGFNTSNSTFYTKRKPLPLPQNHFLDVTTFISSHSHRGNIAFIDSATRRHFTFPQLWLAVDSVSSALSSLGIRKGDVVLLLSPNSIYFPVMSLGAIVTTTNPLNTANEIAKQINDSKPVIAFTTSQLITKIIASSPKLPIILIEENEELQHSGVIDNHHSDFPSSLNVGDNHSYVLCEFFKDAQKKVLPVCRSRLKNVPVARDYTPIN*
• ORF Type: complete

Annotations of Ll_transcript_38593

• Blastp: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 67.1% of identity
• Blastx: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 67.81% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG0318)
• Kegg: Link to kegg annotations (AT1G20510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414061.1)
• Pfam: AMP-binding enzyme (PF00501.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;