Transcript | Ll_transcript_38593 |
---|---|
CDS coordinates | 113-766 (+) |
Peptide sequence | MANQKIDPRSGFNTSNSTFYTKRKPLPLPQNHFLDVTTFISSHSHRGNIAFIDSATRRHFTFPQLWLAVDSVSSALSSLGIRKGDVVLLLSPNSIYFPVMSLGAIVTTTNPLNTANEIAKQINDSKPVIAFTTSQLITKIIASSPKLPIILIEENEELQHSGVIDNHHSDFPSSLNVGDNHSYVLCEFFKDAQKKVLPVCRSRLKNVPVARDYTPIN* |
ORF Type | complete |
Blastp | 4-coumarate--CoA ligase-like 5 from Arabidopsis with 67.1% of identity |
---|---|
Blastx | 4-coumarate--CoA ligase-like 5 from Arabidopsis with 67.81% of identity |
Eggnog | Amp-dependent synthetase and ligase(COG0318) |
Kegg | Link to kegg annotations (AT1G20510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414061.1) |
Pfam | AMP-binding enzyme (PF00501.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer