| Transcript | Ll_transcript_37066 |
|---|---|
| CDS coordinates | 212-700 (+) |
| Peptide sequence | MLGEFITRCLILLLGYAYPGFECYKTVERNKVDFEELRFWCQYWIIVALFTVLEKFADVVIGWLPLYGEMKLALFIYLWYPKTKGTGYVYENVLRPYASKHENDIDIKFQEWRTRAWDLAIFYWQNCTELGQSATFQVLDFLTAQHTKFSGKTKNTKVNFSF* |
| ORF Type | complete |
| Blastp | HVA22-like protein j from Arabidopsis with 58.06% of identity |
|---|---|
| Blastx | HVA22-like protein j from Arabidopsis with 58.06% of identity |
| Eggnog | receptor accessory protein(COG5052) |
| Kegg | Link to kegg annotations (AT2G36020) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456267.1) |
| Pfam | TB2/DP1, HVA22 family (PF03134.18) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer