| Transcript | Ll_transcript_37067 |
|---|---|
| CDS coordinates | 987-1376 (+) |
| Peptide sequence | MKLALFIYLWYPKTKGTGYVYENVLRPYASKHENDIDIKFQEWRTRAWDLAIFYWQNCTELGQSATFQVLDFLTAQHTKFSGKTKNTKKKEKEDPITLYPPSAPPLPDIRASLFQNSEHNFKGKNKKWI* |
| ORF Type | complete |
| Blastp | HVA22-like protein i from Arabidopsis with 48.04% of identity |
|---|---|
| Blastx | HVA22-like protein i from Arabidopsis with 53.4% of identity |
| Eggnog | receptor accessory protein(COG5052) |
| Kegg | Link to kegg annotations (AT5G42560) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456271.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer