Protein coding transcript 258495

• Transcript: Ll_transcript_37077
• CDS coordinates: 212-808 (+)
• Peptide sequence: MLGEFITRCLILLLGYAYPGFECYKTVERNKVDFEELRFWCQYWIIVALFTVLEKFADVVIGWLPLYGEMKLALFIYLWYPKTKGTGYVYENVLRPYASKHENDIDIKFQEWRTRAWDLAIFYWQNCTELGQSATFQVLDFLTAQHTKFSGKTKNTKKKEKEDPITLYPPSAPPLPDIRASLFQNSEHNFKGKNKKWI*
• ORF Type: complete

Annotations of Ll_transcript_37077

• Blastp: HVA22-like protein j from Arabidopsis with 52.78% of identity
• Blastx: HVA22-like protein j from Arabidopsis with 58.94% of identity
• Eggnog: receptor accessory protein(COG5052)
• Kegg: Link to kegg annotations (AT2G36020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456267.1)
• Pfam: TB2/DP1, HVA22 family (PF03134.18)
• Rfam: -
• GO: -