Protein coding transcript 25850

• Transcript: Ll_transcript_522521
• CDS coordinates: 204-896 (+)
• Peptide sequence: MQTLIACSSHSHGKVQSHTNLVPVIIFPKHNSNLSLTRSSSHLILQCKFQPQPFFNSSALVPTSKSPIIFTSNVSPLLCGISSNRYSASGGRSIGEWVELVGEVLSTAFPLWVTVGCVLGLMRPSSFKWVTPQLNIVGLTIVMVCMGMTLSLDDLRGALAMPKEVLSGFVLQYSVMPLSGYFVSKLLNLPSHYAAGLILVGCCPGGTASNIVTYLARYVDSQNCYFKQCF*
• ORF Type: complete

Annotations of Ll_transcript_522521

• Blastp: Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 75.54% of identity
• Blastx: Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 70.11% of identity
• Eggnog: bile acid(COG0385)
• Kegg: Link to kegg annotations (AT1G78560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443834.1)
• Pfam: Sodium Bile acid symporter family (PF01758.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;