Protein coding transcript 258507

• Transcript: Ll_transcript_37093
• CDS coordinates: 308-1282 (+)
• Peptide sequence: MVEWEHKSKVPGKMHACGHDAHAAMLLGAAKILKAHEKEIQGTVVLVFQPAEEGLGGAKKVLDSGALENVSAIFGLHVDPTLPIGEVTTRSGPLFAGCGLFEAIVSGKGGHAAMPQYSIDPIVAASNVVLSLQHLISRETDPLDSKVLTLAKFRGGDAFNVIPDSVTIGGTFRGFSRESMMHLKQRIKQVIIGQASVYRCNASVNFLDEEIPYIPPTFNSDELHKLFESVAGNMFGVNNVKSSELIMASEDFASYQEAMPGYIFLLGIKNISDEHISVPHNPHFQVDEDALPYGAAIHASLASNYLLKLHQDLPLVEEKYNDEL*
• ORF Type: complete

Annotations of Ll_transcript_37093

• Blastp: IAA-amino acid hydrolase ILR1-like 4 from Arabidopsis with 62.35% of identity
• Blastx: IAA-amino acid hydrolase ILR1-like 4 from Arabidopsis with 62.46% of identity
• Eggnog: amidohydrolase(COG1473)
• Kegg: Link to kegg annotations (AT1G51760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436476.1)
• Pfam: Peptidase family M20/M25/M40 (PF01546.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;