Protein coding transcript 25854

• Transcript: Ll_transcript_522513
• CDS coordinates: 2-370 (+)
• Peptide sequence: SALVPASKSPIIFTSNVSPLLCGISSNRYSASGGRSIGEWVELVGEVLSTAFPLWVTVGCVLGLMRPSSFKWVTPQLNIVGLTIVMVCMGMTLSLDDLRGALAMPKEVLSGFVLQYSVSICT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_522513

• Blastp: Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 69.07% of identity
• Blastx: Probable sodium/metabolite cotransporter BASS1, chloroplastic from Arabidopsis with 69.07% of identity
• Eggnog: bile acid(COG0385)
• Kegg: Link to kegg annotations (AT1G78560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443834.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;