Protein coding transcript 258544

• Transcript: Ll_transcript_39835
• CDS coordinates: 111-881 (+)
• Peptide sequence: MASSHTTLFLFLSLSLLILCGHVHSLDLLSDGVHTTSTFFNDTFLKLPSNTVEPSSTCEQTYGFLPCTTTVFGNMFLIIVYGFLMYTAATYLSGGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKETAQSQVSVGMGLLAGSTVLLLTIIWGTCVIVGKCDLEGSIAIDTRDTRGFHLTGSGVSTDIWTSYSARIMVLSVLPFLIVQLPQMLNSTSGRHLAVLIALVVSICLLITYCLYQVNFLLMV*
• ORF Type: complete

Annotations of Ll_transcript_39835

• Blastp: Sodium/calcium exchanger NCL from Arabidopsis with 68.4% of identity
• Blastx: Sodium/calcium exchanger NCL from Arabidopsis with 68.4% of identity
• Eggnog: Calcium-binding EF hand family protein(ENOG410ZVKW)
• Kegg: Link to kegg annotations (AT1G53210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456227.1)
• Pfam: Sodium/calcium exchanger protein (PF01699.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;