Protein coding transcript 258546

• Transcript: Ll_transcript_39811
• CDS coordinates: 1321-1689 (+)
• Peptide sequence: MEDFDASHNNRVDKKEFVSGTCKWLQKAKGSRVASGDAGAHTMKFLSDFHDETKREHDLLDVGGESDEVIEGVGNAGWTTVKAVLLLVLGSLIAAAFADPLVDVVHNFSNATSIPAFFISFIA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_39811

• Blastp: Sodium/calcium exchanger NCL1 from Oryza sativa with 59.35% of identity
• Blastx: Sodium/calcium exchanger NCL from Arabidopsis with 69.57% of identity
• Eggnog: Calcium-binding EF hand family protein(ENOG410ZVKW)
• Kegg: Link to kegg annotations (4325568)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443893.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;