Protein coding transcript 258563

• Transcript: Ll_transcript_38813
• CDS coordinates: 385-1077 (+)
• Peptide sequence: MEGAAGSGTVCVSETCKAHMAMALVQLFYGGYHVITKVALNVGINQLVFCVLRDLTALSILVPLAFFHERGVRPPITKDLLISFFLLGLTGIFSNQLLFVIGLSYTNPTYASAIQPAIPVFTFLFAVVMGTERVNLRRYEGLAKVGGTVISVSGAVAMVLYRGPALIGYTDNVHVAQNEVSARVHAEPPGRFISGLENLGLGHFHLGVICLIGNCICMAAYLAILVCIFC*
• ORF Type: complete

Annotations of Ll_transcript_38813

• Blastp: WAT1-related protein At5g45370 from Arabidopsis with 61.29% of identity
• Blastx: WAT1-related protein At5g45370 from Arabidopsis with 61.29% of identity
• Eggnog: Auxin-induced protein(ENOG4110YP2)
• Kegg: Link to kegg annotations (AT5G45370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422569.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;