Protein coding transcript 258566

• Transcript: Ll_transcript_38826
• CDS coordinates: 385-1539 (+)
• Peptide sequence: MEGAAGSGTVCVSETCKAHMAMALVQLFYGGYHVITKVALNVGINQLVFCVLRDLTALSILVPLAFFHERGVRPPITKDLLISFFLLGLTGIFSNQLLFVIGLSYTNPTYASAIQPAIPVFTFLFAVVMGTERVNLRRYEGLAKVGGTVISVSGAVAMVLYRGPALIGYTDNVHVAQNEVSARVHAEPPGRFISGLENLGLGHFHLGVICLIGNCICMAAYLAILAPVLKKYPANLSATAYSYFFGAILMATVSLFAANELNDWILTPTEVLAVFYSGIIASAVNYGLMTWCNRILGPTLVALFIPLQPGFASLLSQIFLGTPIYLGSILGGSFIIVGLYTVTWASYRDKQTSIEVVPHASWVSEPLIHQTSAYQKGGSSSISP*
• ORF Type: complete

Annotations of Ll_transcript_38826

• Blastp: WAT1-related protein At4g19185 from Arabidopsis with 62.13% of identity
• Blastx: WAT1-related protein At4g19185 from Arabidopsis with 62.13% of identity
• Eggnog: Auxin-induced protein(ENOG4110YP2)
• Kegg: Link to kegg annotations (AT4G19185)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422569.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;